PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G21040.1
Common NameLOC102722844
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 155aa    MW: 17012.4 Da    PI: 8.7728
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G21040.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF35.31.5e-112256943
                  HHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
        SRF-TF  9 rqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                  r   fs+R ++i+ KA+EL +LC++ va + +s++
  OB03G21040.1 22 RDACFSRRHTTIFNKANELAILCGVMVAAVFVSPN 56
                  6778****************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004320.0022767IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.27E-111879IPR002100Transcription factor, MADS-box
PfamPF003194.6E-132064IPR002100Transcription factor, MADS-box
PROSITE profilePS5006610.2742256IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MVKCRPHTSR KMIGVKCGNK VRDACFSRRH TTIFNKANEL AILCGVMVAA VFVSPNANGG  60
IFSFGYPSVS TVANRFLADH AASSTSVSNS TQGGRDVEIR ELEREERELT EQLQASTYQN  120
KLLQEAIAAL DGGRMMQLLR CDFAEFGPKD LVGPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2318011e-133AC231801.1 Oryza minuta clone OM__Ba0163M10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006651224.11e-113PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLJ3LM281e-113J3LM28_ORYBR; Uncharacterized protein
STRINGOB03G21040.11e-113(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2042088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-11AGAMOUS-like 29